General Information

  • ID:  hor000177
  • Uniprot ID:  O97384
  • Protein name:  Crustacean hyperglycemic hormone
  • Gene name:  CHH2
  • Organism:  Penaeus monodon (Giant tiger prawn)
  • Family:  Arthropod CHH/MIH/GIH/VIH hormone family
  • Source:  animal
  • Expression:  eyestalk, brain, and thoracic ganglia
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Penaeus (genus), Penaeidae (family), Penaeoidea (superfamily), Dendrobranchiata (suborder), Decapoda (order), Eucarida (superorder), Eumalacostraca (subclass), Malacostraca (class), Multicrustacea (superclass), Crustacea (subphylum), Pancrustacea, Mandibulata, Arthropoda (phylum), Panarthropoda, Ecdysozoa, Protostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity; GO:0005184 neuropeptide hormone activity
  • GO BP:  GO:0005975 carbohydrate metabolic process; GO:0006006 glucose metabolic process; GO:0007218 neuropeptide signaling pathway
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  AHVQTVGK
  • Length:  8
  • Propeptide:  MTAFRLVAVALVVVVACSTTWARSLEGSSSPVASLIRGRSLSKRANFDPSCAGVYNRELLGRLSRLCDDCYNVFREPKVATECRSNCFYNPVFVQCLEYLIPADLHEEYQAHVQTVGK
  • Signal peptide:  MTAFRLVAVALVVVVACSTTWA
  • Modification:  T6 Valine amide
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  In the control of glucose metabolism
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-O97384-F1(AlphaFold_DB_ID)

  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
    •    hor000177_AF2.pdbhor000177_ESM.pdb

Physical Information

Mass: 96401 Formula: C36H62N12O11
Absent amino acids: CDEFILMNPRSWY Common amino acids: V
pI: 9.7 Basic residues: 2
Polar residues: 2 Hydrophobic residues: 3
Hydrophobicity: -18.75 Boman Index: -749
Half-Life: 4.4 hour Half-Life Yeast: >20 hour
Half-Life E.Coli: >10 hour Aliphatic Index 85
Instability Index: -2308.75 Extinction Coefficient cystines: 0
Absorbance 280nm: 0

Literature

  • PubMed ID:  21459120
  • Title:  Visualization of Neuropeptides in Paraffin-Embedded Tissue Sections of the Central Nervous System in the Decapod Crustacean, Penaeus Monodon, by Imaging Mass Spectrometry